PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT32771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 395aa    MW: 42875.8 Da    PI: 6.2348
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT32771genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.11e-50111411128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
               +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  ++ +  +++wy Fs+rdkky+tg+r+nrat++g+Wkatg+dk+++s+ ++
  EMT32771  11 VPPGFRFHPTEEELLTYYLAKKVASQRIDL-DVIPDVDLNKLEPWDIQErcRIGTgPQNDWYLFSHRDKKYPTGTRTNRATAAGFWKATGRDKAIYSAaGS 110
               69****************************.9***************953444442456**************************************9777 PP

       NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +g++ktLvfykgrap+g+k+dW+mheyrl
  EMT32771 111 GRIGMRKTLVFYKGRAPHGHKSDWIMHEYRL 141
               88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-557178IPR003441NAC domain
PROSITE profilePS5100554.70511178IPR003441NAC domain
PfamPF023651.7E-2612141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MSISVNGQSV VPPGFRFHPT EEELLTYYLA KKVASQRIDL DVIPDVDLNK LEPWDIQERC  60
RIGTGPQNDW YLFSHRDKKY PTGTRTNRAT AAGFWKATGR DKAIYSAAGS GRIGMRKTLV  120
FYKGRAPHGH KSDWIMHEYR LDDAVPVNPT AGDATYYSSD SFPGAEEDEW VIGRVFKKKN  180
IVVQRQAGQN RGVGGAASNQ LVGAGAMERS QSNCSSTVTA SDNAKAQMQQ QPLPHSDDAL  240
DHILSYMGRS STASCEQETK PTNPSSSALD HLINTACHNG SSTLYEKFMK LPPLEHVVPG  300
DLLPSPAEYG GDWDALDRLA AYELNGLPNP ALPETTNGMP YIADELGGAT SYSGGGTLHI  360
PSVTGAGDGD LWSLARPVSS LHADLTMTWF KAVGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-451118015170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2491200.0AK249120.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf17a09, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655752.11e-143PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP63e-98NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM8D8F40.0M8D8F4_AEGTA; NAC domain-containing protein 43
STRINGMLOC_75524.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.18e-89NAC family protein